Войти Регистрация Спроси ai-bota

Во Укажите правильный вариант ответа:
that we didn't enter
so that we don't enter
not to enter
to not enter

Нажмите на рекламу ниже и сразу увидите ответ

↓

Популярные вопросы:

zulaykho001

20.05.2021 18:36

Составить рассказ по этим вопросам)) 1. what kind of newspaper is it? 2. do you buy it or borrow it from someone? 3. how reliable is the information in it? 4. what...

Willowchops

20.05.2021 18:36

Составить словосочетания modern, historical, interesting, famous, lovely, hospitahle, beautiful, traditional, old, building, museum, place, church, cathedral, ciry...

bombila663

20.05.2021 18:36

Read, trace and colour the corresponding pictures. переведите не могу сделать !...

Алинаплавчиха

20.05.2021 18:36

Придумать 5 предложений в страдательном залоге(желательно в разных временах)...

tiMYPkomptik

20.05.2021 18:36

Complete the sentences using the past simple or present perfect form of the verb in brackets. 1. i feel better now that i ) a sleep. 2. my dad ) in a hospital for ten...

forest7775owc130

15.11.2022 23:43

Тапсырмалар: : 1.Complete the sentences with the words- Сөйлемді бір сөзбен толықтырa. Your dad s dad is yourb. Your mum s mum is yourc. Your mum s sister is yourd....

Шатунов1

16.02.2021 22:29

1) i get up (get up) at seven o clock every day....

Anna050503

27.09.2020 21:06

5 Complete the summary in 3 using items A-M from the wordlist below. Wordlist. A) in sequence. B) revolution. C) beneficial effect. D) much. E)messages, letters, electronics...

iraapukhtina7

13.01.2020 22:42

Journey placetimereeffishwildlifecitycolourfulrareancientchallengingbrilliantmysteriouscoralcolourfulrareancientchallengingbrilliantmysteriouscoralНазадДалеечтобы получились...

toptop54

23.08.2021 05:39

Кто выполнить с объяснениями?...

Ответ:

Beario

14.10.2020 02:07

Mary asked us that we didn't enter the room on the left

0,0(0 оценок)

Полный доступ

Позволит учиться лучше и быстрее. Неограниченный доступ к базе и ответам от экспертов и ai-bota Оформи подписку