Войти Регистрация Спроси ai-bota

Что делает дизайнер ответ на языке

Нажмите на рекламу ниже и сразу увидите ответ

↓

Популярные вопросы:

arsenibest03

07.01.2022 23:33

in your country, Explain why it attracted your attention. Use Past Passive if possible. • had been announced that • This information had never been published • A lot of people...

toptop54

23.08.2021 05:39

Кто выполнить с объяснениями?...

iraapukhtina7

13.01.2020 22:42

Journey placetimereeffishwildlifecitycolourfulrareancientchallengingbrilliantmysteriouscoralcolourfulrareancientchallengingbrilliantmysteriouscoralНазадДалеечтобы получились словосочетания...

Anna050503

27.09.2020 21:06

5 Complete the summary in 3 using items A-M from the wordlist below. Wordlist. A) in sequence. B) revolution. C) beneficial effect. D) much. E)messages, letters, electronics negative...

Шатунов1

16.02.2021 22:29

1) i get up (get up) at seven o clock every day....

forest7775owc130

15.11.2022 23:43

Тапсырмалар: : 1.Complete the sentences with the words- Сөйлемді бір сөзбен толықтырa. Your dad s dad is yourb. Your mum s mum is yourc. Your mum s sister is yourd. Your dad s...

Хэйллис

30.01.2022 17:53

£100 million is almost/ nowhere near as much as €300 million. 2 Gold is a little / a lot more expensive than steel. 3 The Pacific Ocean is slightly /far bigger than the Arctic...

Морена1

24.02.2021 03:23

Ito stay at home tomorrow because l m not well перевести в будущее время...

akolosov2002

24.02.2021 03:23

Complete the exchanges with see you later.im fine thanks.hows it going.have a nice evening.nice to meet you.are you anton. 1. a.how are you,vadim? 2.a.bye boris . b.you too, jake....

grasdas

24.02.2021 03:23

Сwrite the correct from of the verb in brackets: 1)he help) her. 2)when the car be) broken ,he fix) it....

Ответ:

ShurenkoPasha12

04.10.2020 13:07

Designer изпластика или из картона делают все ето

0,0(0 оценок)

Полный доступ

Позволит учиться лучше и быстрее. Неограниченный доступ к базе и ответам от экспертов и ai-bota Оформи подписку